PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g077590.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 180aa    MW: 20805.3 Da    PI: 7.5708
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g077590.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.6e-181669356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++ +++++q + Le  F +n++++ +++ +LA++lgL+ rq+ +W+qN+Ra++k
  Sopim02g077590.0.1 16 HKKRLNQDQMRLLEISFSSNNKLDSDRKFQLAQELGLPPRQIAIWYQNKRARWK 69
                        67789************************************************9 PP

2HD-ZIP_I/II108.83.8e-3516107293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +k+rl+++q++lLE sF++++kL+++rK +la+eLgl prq+a+W+qn+RAR+k++ lE+dy++L++++d+  e+ne+L+ eve+Lr+el+
  Sopim02g077590.0.1  16 HKKRLNQDQMRLLEISFSSNNKLDSDRKFQLAQELGLPPRQIAIWYQNKRARWKSQSLEVDYKTLQQRLDNALEDNEKLKLEVERLRKELN 106
                         69**************************************************************************************997 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Sopim02g077590.0.1 107 K 107
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-16972IPR009057Homeodomain-like
SMARTSM003891.0E-141475IPR001356Homeobox domain
PfamPF000464.2E-151669IPR001356Homeobox domain
CDDcd000861.77E-131672No hitNo description
PROSITE profilePS5007115.0941771IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-171878IPR009057Homeodomain-like
PRINTSPR000312.8E-54251IPR000047Helix-turn-helix motif
PROSITE patternPS0002704669IPR017970Homeobox, conserved site
PRINTSPR000312.8E-55167IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MDFLSCQTQK IHLKCHKKRL NQDQMRLLEI SFSSNNKLDS DRKFQLAQEL GLPPRQIAIW  60
YQNKRARWKS QSLEVDYKTL QQRLDNALED NEKLKLEVER LRKELNKNQE VLLGFNTTTT  120
NNYSSISSSC DEVGSTSCLQ LHDQSKHNHL DKDFYACLIG DEGHFGTHDG HNFFASSLS*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233839.21e-131PREDICTED: homeobox-leucine zipper protein ATHB-52
TrEMBLK4B8Y41e-131K4B8Y4_SOLLC; Uncharacterized protein
STRINGSolyc02g077590.1.11e-130(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.12e-24homeobox protein 52